missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human IL-16 (aa 962-1070) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91950
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82627 (PA5-82627. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by IL-16 is a pleiotropic cytokine that functions as a chemoattractant, a modulator of T cell activation, and an inhibitor of HIV replication. The signaling process of this cytokine is mediated by CD4. The product of IL-16 undergoes proteolytic processing, which is found to yield two functional proteins. The cytokine function is exclusively attributed to the secreted C-terminal peptide, while the N-terminal product may play a role in cell cycle control. Caspase 3 is reported to be involved in the proteolytic processing of this protein. Alternate splicing results in multiple transcript variants.Specifications
| Q14005 | |
| Blocking Assay, Control | |
| 3603 | |
| 100 μL | |
| FLJ16806; FLJ42735; FLJ44234; H-IL-16; il 16; Il16; IL-16; ILN; Interleukin; interleukin 16; Interleukin16; Interleukin-16; LCF; Lymphocyte chemoattractant factor; M-IL-16; mKIAA4048; neuronal interleukin 16; NIL16; PRIL16; prIL-16; prointerleukin 16; Pro-interleukin-16 | |
| IL16 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human IL-16 (aa 962-1070) Control Fragment | |
| RUO | |
| IL-16 | |
| Unconjugated | |
| Recombinant | |
| QRARSFPLTRSQSCETKLLDEKTSKLYSISSQVSSAVMKSLLCLPSSISCAQTPCIPKEGASPTSSSNEDSAANGSAETSALDTGFSLNLSELREYTEGLTEAKEDDDG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |