missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90976

Invitrogen™ Human IFNAR1 (aa 276-416) Control Fragment Recombinant Protein

Catalog No. RP90976
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90976 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90976 Supplier Invitrogen™ Supplier No. RP90976
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (43%), Rat (43%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82612 (PA5-82612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Interferons are widely used therapeutic agents because of their anti tumor and antiviral effects and because of their modulatory effects on the immune system (Biron,2001, Kirkwood, 2002). These cytokines produce their effects by binding to the Type 1 Interferon-& Receptor (IFNAR1). Down regulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling. This down regulation is thought to be influenced by phosphorylation of Serine 535 and 539 in the IFNAR1 (Kumar et al., 2003).

Specifications

Accession Number P17181
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3454
Name Human IFNAR1 (aa 276-416) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha-type antiviral protein; AVP; beta-type antiviral protein; CD118; CRF2-1; cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; Ifar; IFN R1; IFNalpha/beta R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR; IFNalpha/betaR1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFNalpha/beta-Ralpha; IFN-alpha-REC; IFNAR; Ifnar1; IFNBR; IFNR1; IFN-R-1; Ifrc; INF-a receptor; Infar; interferon (alpha and beta) receptor 1; interferon (alpha, beta and omega) receptor 1; interferon alpha and beta receptor subunit 1; interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha/beta receptor 1; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; type I interferon receptor 1
Common Name IFNAR1
Gene Symbol Ifnar1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KWKQIPDCENVKTTQCVFPQNVFQKGIYLLRVQASDGNNTSFWSEEIKFDTEIQAFLLPPVFNIRSLSDSFHIYIGAPKQSGNTPVIQDYPLIYEIIFWENTSNAERKIIEKKTDVTVPNLKPLTVYCVKARAHTMDEKLN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less