missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105955

Invitrogen™ Human IFLTD1 Control Fragment Recombinant Protein

Catalog No. RP105955
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105955 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105955 Supplier Invitrogen™ Supplier No. RP105955
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65217 (PA5-65217. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IFLTD1 is a protein coding gene. Gene Ontology (GO) annotations related to this gene include cytoplasm; intermediate filament; nuclear envelope; structural molecule activity; cell population proliferation.

Specifications

Accession Number Q8N9Z9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 160492
Name Human IFLTD1 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4933403M22Rik; AI482300; IFLTD1; intermediate filament tail domain containing 1; intermediate filament tail domain-containing protein 1; lamin A-related sequence 1; lamin tail domain containing 1; lamin tail domain-containing protein 1; Lamin-A-related sequence 1 protein; Lmna1; Lmna-rs1; Lmntd1; PAS1C1; RGD1560077
Common Name IFLTD1
Gene Symbol Lmntd1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KQDQPKKDISNYQVEQAQVLLKREKEIPPTVFPNRSPWCQNPYVSAHPYCPLIEPHNTSTAGGRLDRQPRSRSTRPNRASGSKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less