missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP90843

Invitrogen™ Human HTR2B (aa 240-326) Control Fragment Recombinant Protein

Catalog No. RP90843
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90843 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90843 Supplier Invitrogen™ Supplier No. RP90843
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HTR2B is a g-protein coupled receptor for 5-hydroxytryptamine (serotonin). It functions as a receptor for various ergot alkaloid derivatives and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. HTR2B also plays a role in perception of pain, regulation of behavior. It is required to normal proliferation of embryonic cardiac myocytes and normal heart development.

Specifications

Accession Number P41595
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3357
Name Human HTR2B (aa 240-326) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5-HT 2 B receptor; 5-HT(2 B); 5-HT2B; 5-HT-2 B; 5 HT2B Receptor; 5-HT2b receptor; 5-HT-2 F; 5-hydroxytryptamine (serotonin) receptor 2 B; 5-hydroxytryptamine (serotonin) receptor 2 B, G protein-coupled; 5-hydroxytryptamine 2 B receptor; 5-hydroxytryptamine receptor 2 B; 5-hydroxytryptamine receptor 2 B variant b; AJ012488; AV377389; HTR2B; NP75 protein; serotonin receptor 2 B; Srl; Stomach fundus serotonin receptor
Common Name HTR2B
Gene Symbol HTR2B
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less