missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94755

Invitrogen™ Human HSPA9 (aa 528-667) Control Fragment Recombinant Protein

Catalog No. RP94755
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94755 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94755 Supplier Invitrogen™ Supplier No. RP94755

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The HSP70 family is composed of four highly conserved proteins: HSP70, HSC70, GRP75 and GRP78. These proteins serve a variety of roles. GRP75 expression is restricted to the mitochondrial matrix and aids in the translocation and folding of nascent polypeptide chains of both nuclear and mitochondrial origin. GRP75 and GRP78 are unresponsive to heat stress and are induced by glucose deprivation.

Specifications

Accession Number P38646
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3313
Name Human HSPA9 (aa 528-667) Control Fragment
Quantity 100 μL
Gene Alias 70 kDa heat shock protein; 74 kDa; 75 kDa glucose-regulated protein; C3H-specific antigen; catecholamine-regulated protein 40; CRP40; CSA; epididymis secretory sperm binding protein Li 124 m; EVPLS; GRP 75; GRP75; GRP-75; heat shock 70 kDa protein 9; heat shock 70 kDa protein 9 B; heat shock 70 kD protein 9 B; heat shock 70 kDa protein 9 (mortalin); heat shock 70 kDa protein 9 A; heat shock 70 kDa protein 9 B (mortalin-2); Heat shock protein; heat shock protein 9; heat shock protein 9 A; heat shock protein cognate 74; heat shock protein family A (Hsp70) member 9; heat shock protein family A (Hsp70) member 9 S homeolog; heat shock protein, 74 kDa, A; heat shock protein, A; HEL-S-124 m; Hsc74; HSP; Hsp74; Hsp74a; hspa9; hspa9.S; Hspa9a; hspa9-a; hspa9b; hspa9-b; hypothetical protein; I79_009139; MGC4500; mortalin; mortalin, perinuclear; mortalin2; mortalin-2; mot; MOT2; Mot-2; Mthsp70; mt-HSP70; MTHSP75; p66 MOT; p66-mortalin; pbp74; Peptide-binding protein 74; RCJMB04_2m8; SAAN; SIDBA4; stress-70 protein mitochondrial-like protein; stress-70 protein, mitochondrial; Stress-70 protein, mitochondrial-like protein; XELAEV_18020021mg
Common Name HSPA9
Gene Symbol HSPA9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKMEEFKDQLPADECNKLKEEISKMRELLARKDSETGENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less