missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106522

Invitrogen™ Human HP1BP3 (aa 317-398) Control Fragment Recombinant Protein

Catalog No. RP106522
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106522 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106522 Supplier Invitrogen™ Supplier No. RP106522

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65854 (PA5-65854. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HP1BP3 is the component of heterochromatin, may be involved in chromatin structure and function.

Specifications

Accession Number Q5SSJ5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 50809
Name Human HP1BP3 (aa 317-398) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias heterochromatin protein 1 binding protein 3; heterochromatin protein 1, binding protein 3; heterochromatin protein 1-binding protein 3; Hp1bp3; HP1BP74; HP1-BP74; Protein HP1-BP74
Common Name HP1BP3
Gene Symbol HP1BP3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ITGKGASGTFQLKKSGEKPLLGGSLMEYAILSAIAAMNEPKTCSTTALKKYVLENHPGTNSNYQMHLLKKTLQKCEKNGWME
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less