missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human hnRNP H2 (aa 324-438) Control Fragment Recombinant Protein

Catalog No. RP91891
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91891 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91891 Supplier Invitrogen™ Supplier No. RP91891
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-81904 (PA5-81904, PA5-51566 (PA5-51566. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that binds to RNAs. It is very similar to the family member HNRPH1. This gene is thought to be involved in Fabray disease and X-linked agammaglobulinemia phenotype. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq].

Specifications

Accession Number P55795
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3188
Name Human hnRNP H2 (aa 324-438) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias DXHXS1271E; Ftp3; Ftp-3; H'; Heterogeneous nuclear ribonucleoprotein H'; heterogeneous nuclear ribonucleoprotein H2; heterogeneous nuclear ribonucleoprotein H2 (H'); Heterogeneous nuclear ribonucleoprotein H2, N-terminally processed; heterogeneous nuclear ribonucleoprotein H-prime; HNRNP; hnRNP H'; hnRNP H2; hnRNPH'; Hnrnph2; HNRPH'; HNRPH2
Common Name hnRNP H2
Gene Symbol HNRNPH2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DGRVTGEADVEFATHEDAVAAMAKDKANMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYGGGYGGQSSMSGYDQVLQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less