missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HINT3 Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94657
Description
Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55729 (PA5-55729. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides. Hydrolyzes phosphoramidate and acyl-adenylate substrates.Specifications
| Q9NQE9 | |
| Blocking Assay, Control | |
| 135114 | |
| 100 μL | |
| HINT3; HINT-3; HINT4; histidine triad nucleotide binding protein 3; histidine triad nucleotide-binding protein 3; HIT-like protein | |
| HINT3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human HINT3 Control Fragment | |
| RUO | |
| HINT3 | |
| Unconjugated | |
| Recombinant | |
| MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |