missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98477

Invitrogen™ Human HIF3A (aa 411-486) Control Fragment Recombinant Protein

Catalog No. RP98477
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98477 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98477 Supplier Invitrogen™ Supplier No. RP98477
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Cell growth and viability is compromised by oxygen deprivation (hypoxia). Hypoxia-inducible factors, including HIF-1 alpha, HIF-1 beta (also designated Arnt 1), EPAS-1 (also designated HIF-2 alpha) and HIF-3 alpha, induce glycolysis, erythropoiesis and angiogenesis in order to restore oxygen homeostasis. Hypoxia-inducible factors are members of the Per-Arnt-Sim (PAS) domain transcription factor family. In response to hypoxia, HIF-1 alpha is upregulated and forms a heterodimer with Arnt 1 to form the HIF-1 complex. The HIF-1 complex recognizes and binds to the hypoxia responsive element (HRE) of hypoxia-inducible genes, thereby activating transcription.

Specifications

Accession Number Q9Y2N7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64344
Name Human HIF3A (aa 411-486) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Basic-helix-loop-helix-PAS protein MOP7; BHLHE17; Class E basic helix-loop-helix protein 17; HIF-3 alpha; HIF3 alpha 1; HIF3A; HIF-3 A; HIF-3-alpha; HIF3-alpha; HIF3-alpha-1; hypoxia inducible factor 3 alpha; hypoxia inducible factor 3 alpha subunit; hypoxia inducible factor 3, alpha subunit; hypoxia inducible factor 3 A; hypoxia inducible factor three alpha; hypoxia-inducible factor 3 alpha; hypoxia-inducible factor 3-alpha; Inhibitory PAS domain protein; IPAS; Member of PAS protein 7; Mop7; Neonatal and embryonic PAS protein; NEPAS; PAS domain-containing protein 7; PASD7
Common Name HIF3A
Gene Symbol HIF3A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less