missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105850

Invitrogen™ Human HIF-2 alpha (aa 323-417) Control Fragment Recombinant Protein

Catalog No. RP105850
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105850 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105850 Supplier Invitrogen™ Supplier No. RP105850
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HIF-2 alpha (Epas1) is a transcription factor involved in the induction of genes regulated by oxygen. HIF-2 alpha contains a basic-helix-loop-helix domain protein dimerization domain as well as a domain found in proteins in signal transduction pathways which respond to oxygen levels. It also regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of the lungs. Mutations in this gene are associated with erythrocytosis familial type 4.

Specifications

Accession Number Q99814
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2034
Name Human HIF-2 alpha (aa 323-417) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias basic-helix-loop-helix-PAS protein MOP2; bHLHe73; Class E basic helix-loop-helix protein 73; ECYT4; endothelial PAS domain protein 1; endothelial PAS domain protein 1 b; endothelial PAS domain-containing protein 1; endothelial PAS domain-containing protein 1 b; EPAS; Epas1; EPAS-1; epas1b; Hif like protein; HIF1 alpha-like factor; HIF-1-alpha-like factor; HIF-1 alpha-like factor; HIF1alpha-like factor; HIF2 alpha; HIF-2 alpha; HIF2A; hif-2 A; hif-2 ab; HIF-2 alpha; HIF-2-alpha; HIF2-alpha; HIF-related factor; HLF; HLF (HIF1alpha-like factor); HRF; hypoxia inducible factor 2 alpha; hypoxia inducible factor 2, alpha subunit; hypoxia inducible factor 2 A; hypoxia inducible transcription factor 2 alpha; hypoxia-inducible factor 2 alpha; hypoxia-inducible factor 2-alpha; Member of PAS protein 2; mHLF; MOP2; PAS domain-containing protein 2; PASD2; wu:fq36f01
Common Name HIF-2 alpha
Gene Symbol EPAS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GTVIYNPRNLQPQCIMCVNYVLSEIEKNDVVFSMDQTESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGDAIISLDFG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less