missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89770

Invitrogen™ Human HGK (aa 619-737) Control Fragment Recombinant Protein

Catalog No. RP89770
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89770 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89770 Supplier Invitrogen™ Supplier No. RP89770

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82354. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAP4K4 (HGK) is a serine/threonine kinase which plays an important role in stress-activated MAPK core signaling pathways, the response to environmental stress and cytokines such as TNF-alpha. It appears to act upstream of the JUN N-terminal pathway. This protein is thought to interact with the SH3 domain of the adapter proteins Nck. HGK binds, via its CNH regulatory domain, to the N-terminal region of SPG3A. Expression appears to be ubiquitous, expressed in all tissue types examined. Isoform 5 appears to be more abundant in the brain, and isoform 4 is predominant in the liver, skeletal muscle and placenta.

Specifications

Accession Number O95819
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9448
Name Human HGK (aa 619-737) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 9430080K19Rik; AU043147; AU045934; AW046177; epididymis secretory protein Li 31; FLH21957; FLJ10410; FLJ20373; FLJ90111; HEL-S-31; hepatocyte progenitor kinase-like/germinal center kinase-like kinase; HGK; HPK/GCK-like kinase HGK; KIAA0687; Map4k4; MAPK/ERK kinase kinase kinase 4; MEK kinase kinase 4; MEKKK 4; MEKKK4; mitogen activated protein kinase kinase kinase kinase 4; mitogen-activated protein kinase kinase kinase kinase 4; NCK interacting kinase; nck-interacting kinase; NIK; Ste20 group protein kinase HGK
Common Name HGK
Gene Symbol MAP4K4
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQDPCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPVLSRRDSPLQGSGQQNSQAGQRNSTSSI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less