missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102643

Invitrogen™ Human HFM1 (aa 1187-1273) Control Fragment Recombinant Protein

Catalog No. RP102643
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102643 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102643 Supplier Invitrogen™ Supplier No. RP102643
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83256 (PA5-83256. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is thought to be an ATP-dependent DNA helicase and is expressed mainly in germ-line cells. Defects in this gene are a cause of premature ovarian failure 9 (POF9).

Specifications

Accession Number A2PYH4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 164045
Name Human HFM1 (aa 1187-1273) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A330009G12Rik; Gm1046; helicase; helicase-like protein HFM1; Hfm1; HFM1, ATP dependent DNA helicase homolog; HFM1, ATP-dependent DNA helicase homolog; HFM1, ATP-dependent DNA helicase homolog (S. cerevisiae); Mer3; POF9; probable ATP-dependent DNA helicase HFM1; RP11-539G11.1; SEC3D1; SEC63 domain containing 1; SEC63 domain-containing protein 1; SEC63D1; Si-11; Si-11-6
Common Name HFM1
Gene Symbol HFM1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SSVPPVKRLKIQMNKSQSVDLKEFGFTPKPSLPSISRSEYLNISELPIMEQWDQPEIYGKVRQEPSEYQDKEVLNVNFELGNEVWDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less