missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108068

Invitrogen™ Human HERPUD2 (aa 10-89) Control Fragment Recombinant Protein

Catalog No. RP108068
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108068 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108068 Supplier Invitrogen™ Supplier No. RP108068

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67404 (PA5-67404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Could be involved in the unfolded protein response (UPR) pathway.

Specifications

Accession Number Q9BSE4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64224
Name Human HERPUD2 (aa 10-89) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias HERPUD family member 2; HERPUD2; homocysteine-inducible, endoplasmic reticulum stress-inducible, ubiquitin-like domain member 2; homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Common Name HERPUD2
Gene Symbol HERPUD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPLTKDQRLVYSGRLLPDHLQLKDILRKQDEYHMVHLVCTSR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less