missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HEMK1 (aa 237-326) Control Fragment Recombinant Protein

Catalog No. RP96312
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96312 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96312 Supplier Invitrogen™ Supplier No. RP96312

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57023 (PA5-57023. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

N5-glutamine methyltransferase responsible for the methylation of the glutamine residue in the universally conserved GGQ motif of the mitochondrial translation release factor MTRF1L. [UniProt]

Specifications

Accession Number Q9Y5R4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51409
Name Human HEMK1 (aa 237-326) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310008M14Rik; AW049265; HEMK; HEMK homolog 7 kb; hemK methyltransferase family member 1; HEMK1; M.HsaHemKP; MTQ1; MTRF1L release factor glutamine methyltransferase; RGD1308293; testis secretory sperm-binding protein Li 225 n
Common Name HEMK1
Gene Symbol HEMK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILALAPRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less