missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HECTD3 (aa 181-269) Control Fragment Recombinant Protein

Catalog No. RP94174
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94174 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94174 Supplier Invitrogen™ Supplier No. RP94174
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

E3 ubiquitin ligases accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Mediates ubiquitination of TRIOBP and its subsequent proteasomal degradation, thus facilitating cell cycle progression by regulating the turn-over of TRIOBP. Mediates also ubiquitination of STX8.

Specifications

Accession Number Q5T447
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79654
Name Human HECTD3 (aa 181-269) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700064K09Rik; AI467540; AW743312; E3 ubiquitin-protein ligase HECTD3; HECT domain containing 3; HECT domain containing E3 ubiquitin protein ligase 3; HECT domain E3 ubiquitin protein ligase 3; HECT domain-containing protein 3; HECTD3; HECT-type E3 ubiquitin transferase HECTD3; probable E3 ubiquitin-protein ligase HECTD3; RGD1309823
Common Name HECTD3
Gene Symbol HECTD3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSVKQYVESIDVSSYTEEFNVSCLTDSNADTY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less