missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP92991

Invitrogen™ Human HAUS6 (aa 149-242) Control Fragment Recombinant Protein

Numéro de catalogue. RP92991
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP92991 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP92991 Fournisseur Invitrogen™ Code fournisseur RP92991
Il en reste null

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54285 (PA5-54285. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HAUS6 is 1 of 8 subunits of the 390-kDa human augmin complex, or HAUS complex. The augmin complex was first identified in Drosophila, and its name comes from the Latin verb augmentare, meaning to increase. The augmin complex is a microtubule-binding complex involved in microtubule generation within the mitotic spindle and is vital to mitotic spindle assembly (Goshima et al., 2008 ; Uehara et al., 2009 ).

Spécifications

Accession Number Q7Z4H7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54801
Name Human HAUS6 (aa 149-242) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6230416J20Rik; 9830144E06; D4Ertd27e; Dgt6; dim gamma-tubulin homolog; FAM29A; family with sequence similarity 29, member A; HAUS augmin like complex subunit 6; HAUS augmin-like complex subunit 6; HAUS augmin-like complex, subunit 6; Haus6; KIAA1574; likely ortholog of H. sapiens family with sequence similarity 29, member A (FAM29A); mKIAA1574
Common Name HAUS6
Gene Symbol HAUS6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HHFVETFNIKPQDLHKCIARCHFARSRFLQILQRQDCVTQKYQENAQLSVKQVRNLRSECIGLENQIKKMEPYDDHSNMEEKIQKVRSLWASVN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats