missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HAP40 (aa 279-371) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104413
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61382 (PA5-61382. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Huntington's disease is caused by an expanded CAG trinucleotide repeat coding for a polyglutamine stretch within the Huntington protein. Huntington co-purifies with a single novel 40 kDa protein designated HAP40. Recombinant HAP40 is cytoplasmic in the presence of Huntington but is actively targeted to the nucleus in the absence of Huntington. These observations suggest that HAP40°Contributes to the function of normal Huntington and is a candidate for involvement in the aberrant nuclear localization of mutant Huntington found in degenerating neurons in Huntington's disease.Specifications
| P23610 | |
| Blocking Assay, Control | |
| 474383, 474384, 8263 | |
| 100 μL | |
| 40-kDa huntingtin-associated protein; AI852759; coagulation factor VIII-associated (intronic transcript) 1; coagulation factor VIII-associated 1; cpG island protein; DXS522E; DXUcsf1; F8A; F8A1; F8A2; F8A3; factor 8-associated gene A; Factor VIII associated protein; factor VIII intron 22 protein; HAP40; huntingtin-associated protein 40; RP23-114O19.4 | |
| F8a1, F8a2, F8a3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human HAP40 (aa 279-371) Control Fragment | |
| RUO | |
| HAP40 | |
| Unconjugated | |
| Recombinant | |
| LLQPPPAKLLPEHAQTLEKYSWEAFDSHGQESSGQLPEELFLLLQSLVMATHEKDTEAIKSLQVEMWPLLTAEQNHLLHLVLQETISPSGQGV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |