missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104782

Invitrogen™ Human HADH (aa 133-219) Control Fragment Recombinant Protein

Catalog No. RP104782
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104782 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104782 Supplier Invitrogen™ Supplier No. RP104782
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83688 (PA5-83688. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15.

Specifications

Accession Number Q16836
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3033
Name Human HADH (aa 133-219) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA409008; AU019341; AW742602; Had; HADH; HADH1; HADHSC; HCDH; HHF4; hydroxyacyl-CoA dehydrogenase; hydroxyacyl-Coenzyme A dehydrogenase; hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; hydroxylacyl-Coenzyme A dehydrogenase short chain; hydroxylacyl-Coenzyme A dehydrogenase, short chain; hydroxylacyl-Coenzyme A dehydrogenase-dehydrogenase; L-3-hydroxyacyl-CoA dehydrogenase; L-3-hydroxyacyl-Coenzyme A dehydrogenase, short chain; M/SCHAD; medium and short chain L-3-hydroxyacyl-coenzyme A dehydrogenase; medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; MGC8392; Mschad; SCHAD; short chain 3-hydroxyacyl-CoA dehydrogenase; short-chain 3-hydroxyacyl-CoA dehydrogenase; testis secretory sperm-binding protein Li 203 A
Common Name HADH
Gene Symbol HADH
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less