missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human HAAO (aa 199-279) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104132
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59826 (PA5-59826. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
HAAO (3-Hydroxyanthranilate 3, 4-dioxygenase) is a monomeric cytosolic protein of the family of intramolecular dioxygenases containing non-heme ferrous iron. It is widely distributed in peripheral organs, such as liver and kidney, and is present in low amounts in the central nervous system. This enzyme participates in tryptophan metabolism. It employs one cofactor, iron. HAAO catalyzes the synthesis of quinolinic acid (QUIN) from 3-hydroxyanthranilic acid. QUIN is an excitotoxin whose toxicity is mediated by its ability to activate glutamate N-methyl-D-aspartate receptors. Increased cerebral levels of QUIN may participate in the pathogenesis of neurological and inflammatory disorders. HAAO has been suggested to play a role in disorders associated with altered tissue levels of QUIN. Furthermore, recent study shows that HAAO are excellent candidate biomarkers for detecting ovarian cancer.Specifications
| P46952 | |
| Blocking Assay, Control | |
| 23498 | |
| 100 μL | |
| 0610007K21Rik; 0610012J07Rik; 3 HAO; 3-HAO; 3-HAO {ECO:0000255; 3-HAOxase; 3-hydroxyanthranilate 3,4-dioxygenase; 3-hydroxyanthranilate 3,4-dioxygenase {ECO:0000255; 3-hydroxyanthranilate oxygenase; 3-hydroxyanthranilate oxygenase {ECO:0000255; 3-hydroxyanthranilic acid dioxygenase; 3-hydroxyanthranilic acid dioxygenase {ECO:0000255; Haao; HAD; HAD {ECO:0000255; HAMAP-Rule:MF_03019}; HAO | |
| HAAO | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human HAAO (aa 199-279) Control Fragment | |
| RUO | |
| HAAO | |
| Unconjugated | |
| Recombinant | |
| PLSLFGDTYETQVIAYGQGSSEGLRQNVDVWLWQLEGSSVVTMGGRRLSLAPDDSLLVLAGTSYAWERTQGSVALSVTQDP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |