missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96105

Invitrogen™ Human GTPBP9 (aa 42-129) Control Fragment Recombinant Protein

Catalog No. RP96105
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96105 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96105 Supplier Invitrogen™ Supplier No. RP96105

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83287. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.

Specifications

Accession Number Q9NTK5
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 29789
Name Human GTPBP9 (aa 42-129) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2510025G09Rik; 2810405J23Rik; 2810409H07Rik; DNA damage-regulated overexpressed in cancer 45; DOC45; fe36h01; GBP45; GTBP9; GTP-binding protein 9; GTP-binding protein 9 (putative); GTP-binding protein PTD004; Gtpbp9; HAMAP-Rule:MF_03167}; Obg like ATPase 1; Obg-like ATPase 1; obg-like ATPase 1 {ECO:0000255; obg-like ATPase 1; LOW QUALITY PROTEIN: obg-like ATPase 1; obg-like ATPase 1-like protein; OLA1; PRO2455; PTD004; RGD1307982; similar to Putative GTP-binding protein PTD004; Unknown (protein for MGC:55768); wu:fc66b09; wu:fe36h01; wu:fk82a02; zgc:55768; zgc:55768 protein; zgc:85691
Common Name GTPBP9
Gene Symbol OLA1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LTNSQASAENFPFCTIDPNESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGIFHLTRAFED
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less