missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101825

Invitrogen™ Human GTF3C6 (aa 158-213) Control Fragment Recombinant Protein

Catalog No. RP101825
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101825 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101825 Supplier Invitrogen™ Supplier No. RP101825
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63948 (PA5-63948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

Accession Number Q969F1
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 112495
Name Human GTF3C6 (aa 158-213) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias bA397G5.3; C6orf51; CDA020; General transcription factor 3 C polypeptide 6; general transcription factor IIIC subunit 6; general transcription factor IIIC, polypeptide 6, alpha 35 kDa; GTF3C6; NPD020; TFIIIC 35 kDa subunit; TFIIIC35; Transcription factor IIIC 35 kDa subunit; transcription factor IIIC 35 kDa; transcription factor IIIC subunit 6
Common Name GTF3C6
Gene Symbol GTF3C6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less