missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93951

Invitrogen™ Human GTF2E2 (aa 3-78) Control Fragment Recombinant Protein

Catalog No. RP93951
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93951 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93951 Supplier Invitrogen™ Supplier No. RP93951

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55220 (PA5-55220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The general transcription factor IIE (TFIIE) is part of the RNA polymerase II transcription initiation complex, recruiting TFIIH and being essential for promoter clearance by RNA polymerase II. TFIIE is a heterodimer (and sometimes heterotetramer) of alpha and beta subunits. The protein encoded by this gene represents the beta subunit of TFIIE.

Specifications

Accession Number P29084
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2961
Name Human GTF2E2 (aa 3-78) Control Fragment
Quantity 100 μL
Gene Alias 34 kDa; AI462509; C330006J08Rik; FE; general transcription factor II E, polypeptide 2 (beta subunit); general transcription factor II E, polypeptide 2 (beta subunit, 34 kD); general transcription factor IIE subunit 2; general transcription factor IIE, polypeptide 2 (beta subunit); general transcription factor IIE, polypeptide 2 (beta subunit, 34 kD); general transcription factor IIE, polypeptide 2, beta; general transcription factor IIE, polypeptide 2, beta 34 kDa; Gtf2e2; T2EB; TF2E2; TFIIE beta subunit; TFIIE-B; TFIIE-beta; transcription initiation factor IIE subunit beta; TTD6
Common Name GTF2E2
Gene Symbol GTF2E2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less