missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. RP109073

Invitrogen™ Human GSR (aa 251-327) Control Fragment Recombinant Protein

Numéro de catalogue. RP109073
Modifier l'affichage
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
RP109073 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Numéro de catalogue. RP109073 Fournisseur Invitrogen™ Code fournisseur RP109073

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found.

Spécifications

Accession Number P00390
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2936
Name Human GSR (aa 251-327) Control Fragment
Quantity 100 μL
Gene Alias AI325518; D8Ertd238e; epididymis luminal protein 75; epididymis secretory sperm binding protein Li 122 m; GLUR; glutathione reductase; glutathione reductase 1; glutathione reductase, mitochondrial; glutathione S-reductase; glutathione-disulfide reductase; GR; Gr1; Gr-1; GRase; GRD1; GSR; HEL-75; HEL-S-122 m; hypothetical protein LOC553575; zgc:110010
Common Name GSR
Gene Symbol Gsr
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus de résultats Afficher moins de résultats