missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GSR (aa 251-327) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109073
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found.Specifications
| P00390 | |
| Blocking Assay, Control | |
| 2936 | |
| 100 μL | |
| AI325518; D8Ertd238e; epididymis luminal protein 75; epididymis secretory sperm binding protein Li 122 m; GLUR; glutathione reductase; glutathione reductase 1; glutathione reductase, mitochondrial; glutathione S-reductase; glutathione-disulfide reductase; GR; Gr1; Gr-1; GRase; GRD1; GSR; HEL-75; HEL-S-122 m; hypothetical protein LOC553575; zgc:110010 | |
| Gsr | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GSR (aa 251-327) Control Fragment | |
| RUO | |
| GSR | |
| Unconjugated | |
| Recombinant | |
| SALGSKTSLMIRHDKVLRSFDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLEVSMVTAVPGRLPVMTMIPDVD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |