missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GSG2 (aa 682-768) Control Fragment Recombinant Protein

Catalog No. RP95239
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95239 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95239 Supplier Invitrogen™ Supplier No. RP95239

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55608 (PA5-55608. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GSG2 (haspin) is a conserved kinase required for mitosis. GSG2 phosphorylates histone H3 and is viewed as a potential therapeutic target for oncology. GSG2 is required for normal alignment of chromosomes at metaphase.

Specifications

Accession Number Q8TF76
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83903
Name Human GSG2 (aa 682-768) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias germ cell associated 2 (haspin); germ cell associated 2, haspin; germ cell-specific gene 2 protein; GSG2; haploid germ cell-specific nuclear protein kinase; HASPIN; H-haspin; Serine/threonine-protein kinase haspin
Common Name GSG2
Gene Symbol HASPIN
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QVSIIDYTLSRLERDGIVVFCDVSMDEDLFTGDGDYQFDIYRLMKKENNNRWGEYHPYSNVLWLHYLTDKMLKQMTFKTKCNTPAMK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less