missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Growth Hormone Receptor (aa 49-152) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105082
Description
Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66102 (PA5-66102. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
may play a role in chondrocyte differentiation and positive regulation of longitudinal bond growth and.Specifications
| P10912 | |
| Blocking Assay, Control | |
| 2690 | |
| 100 μL | |
| GH receptor; GH-binding protein; GHBP; GHIP; GHR; GHR/BP; growth hormone binding protein; growth hormone receptor; growth hormone receptor precursor; Growth hormone receptor precursor (GH receptor) (GH binding protein) (GHBP) (Serum binding protein); growth hormone receptor precursor splice variant D56; growth hormone receptor variant d5-6; growth hormone receptor/binding protein; Growth hormone-binding protein; MGC124963; MGC156665; serum binding protein; Serum-binding protein; Somatotropin receptor; unnamed protein product | |
| GHR | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Growth Hormone Receptor (aa 49-152) Control Fragment | |
| RUO | |
| Growth Hormone Receptor | |
| Unconjugated | |
| Recombinant | |
| KEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSFTSIWIPYCIKLTSNGGTVDEKCFSVDEIVQPDPP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |