missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GRASP55 (aa 203-276) Control Fragment Recombinant Protein

Catalog No. RP96030
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96030 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96030 Supplier Invitrogen™ Supplier No. RP96030

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57210. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GRASP55 is a PDZ containing protein involved in the stacking of golgi cisternea in a cell-free system.

Specifications

Accession Number Q9H8Y8
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 26003
Name Human GRASP55 (aa 203-276) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 0610011A07Rik; 2410043M02Rik; 5730520M13Rik; 9430094F20Rik; AW552058; golgi phosphoprotein 6; golgi reassembly stacking protein 2; golgi reassembly stacking protein 2, 55kDa; Golgi reassembly-stacking protein 2; Golgi reassembly-stacking protein of 55 kDa; GOLPH2; GOLPH6; Gorasp2; GRASP55; GRS2; LOW QUALITY PROTEIN: Golgi reassembly-stacking protein 2; p59
Common Name GRASP55
Gene Symbol GORASP2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PTRPFEEGKKISLPGQMAGTPITPLKDGFTEVQLSSVNPPSLSPPGTTGIEQSLTGLSISSTPPAVSSVLSTGV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less