missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GPRASP1 (aa 621-745) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91954
Description
Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51356 (PA5-51356. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Modulates lysosomal sorting and functional down-regulation of a variety of G-protein coupled receptors. Targets receptors for degradation in lysosomes via its interaction with BECN2.Specifications
| Q5JY77 | |
| Blocking Assay, Control | |
| 9737 | |
| 100 μL | |
| 2210415K24Rik; 3110031O14Rik; C87852; G protein-coupled receptor associated sorting protein 1; GASP; GASP1; GASP-1; GPRASP1; G-protein coupled receptor-associated sorting protein 1; KIAA0443; Per1 interacting protein; per1-interacting protein; Pips | |
| GPRASP1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GPRASP1 (aa 621-745) Control Fragment | |
| RUO | |
| GPRASP1 | |
| Unconjugated | |
| Recombinant | |
| VEACVEGDVNSKSSLEDKEEAMIPCFGAKEEVSMKHGTGVRCRFMAGAEETNNKSCFWAEKEPCMYPAGGGSWKSRPEEEEDIVNSWFWSRKYTKPEAIIGSWLWATEESNIDGTGEKAKLLTEE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |