missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104889

Invitrogen™ Human GPR64 (aa 99-226) Control Fragment Recombinant Protein

Catalog No. RP104889
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104889 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104889 Supplier Invitrogen™ Supplier No. RP104889

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65594 (PA5-65594. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Could be involved in a signal transduction pathway controlling epididymal function and male fertility.

Specifications

Accession Number Q8IZP9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10149
Name Human GPR64 (aa 99-226) Control Fragment
Quantity 100 μL
Gene Alias ADGRG2; adhesion G protein-coupled receptor G2; adhesion G-protein coupled receptor G2; AW212196; B830041D06Rik; CTD-2245E12.1; EDDM6; epididymal protein 6; epididymis-specific protein 6; FLJ00282; G protein-coupled receptor 64; G protein-coupled receptor, epididymis-specific (seven transmembrane family); Gpr64; G-protein coupled receptor 64; He6; Human epididymis-specific protein 6; LNB-TM7 heptahelical receptor Me6; Me6; MGC104454; MGC138738; MGC138739; Mouse epididymis-specific protein 6; Rat epididymis-specific protein 6; Re6; re6 receptor; TM7LN2
Common Name GPR64
Gene Symbol ADGRG2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NASGVKPQRNICNLSSICNDSAFFRGEIMFQYDKESTVPQNQHITNGTLTGVLSLSELKRSELNKTLQTLSETYFIMCATAEAQSTLNCTFTIKLNNTMNACAVIAALERVKIRPMEHCCCSVRIPCP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less