missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GPR41 (aa 286-343) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100019
Description
Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60791 (PA5-60791. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a role in many different stimulus-response pathways. GPRs translate extracellular signals into intracellular signals (a process called G-protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters. GPR41 (G-protein coupled receptor 41), also known as FFAR3 (Free fatty acid receptor 3), is a 346 amino acid multi-pass membrane protein that belongs to the G protein-coupled receptor family. Expressed at high levels in adipose tissue and at lower levels throughout the body, GPR41 functions as a receptor for short chain fatty acids via elevation of intracellular calcium levels and inhibition of adenylyl cyclase.Specifications
| O14843 | |
| Blocking Assay, Control | |
| 2865 | |
| 100 μL | |
| FFA3R; FFAR3; Free fatty acid receptor 3; G protein-coupled receptor 41; Gm478; Gpcr41; GPR41; GPR42; G-protein coupled receptor 41; putative G protein-coupled receptor GPR41 | |
| FFAR3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GPR41 (aa 286-343) Control Fragment | |
| RUO | |
| GPR41 | |
| Unconjugated | |
| Recombinant | |
| DFHELLRRLCGLWGQWQQESSMELKEQKGGEEQRADRPAERKTSEHSQGCGTGGQVAC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |