missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GOT2 (aa 149-211) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP109845
Description
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GOT2 is a glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Specifications
| P00505 | |
| Blocking Assay, Control | |
| 2806 | |
| 100 μL | |
| AL022787; aspartate aminotransferase 2; aspartate aminotransferase precursor (EC 2.6.1.1); aspartate aminotransferase, mitochondrial; aspartate transaminase 2; ASPATA; FABP-1; FABPpm; FABP-pm; fatty acid-binding protein; FLJ40994; Glutamate oxaloacetate transaminase 2; glutamate oxaloacetate transaminase 2, mitochondrial; Glutamate oxaloacetate transaminase 2, mitochondrial (aspartate aminotransferase 2); glutamatic-oxaloacetic transaminase 2, mitochondrial; glutamic-oxaloacetic transaminase 2; glutamic-oxaloacetic transaminase 2, mitochondrial; glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2); GOT2; Got-2; KAT4; KATIV; KYAT4; kynurenine aminotransferase 4; Kynurenine aminotransferase IV; kynurenine--oxoglutarate transaminase 4; Kynurenine--oxoglutarate transaminase IV; Maat; mAspAT; mitAAT; mitochondrial aspartate aminotransferase; plasma membrane fatty acid binding protein; plasma membrane-associated fatty acid-binding protein; Transaminase A | |
| GOT2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GOT2 (aa 149-211) Control Fragment | |
| RUO | |
| GOT2 | |
| Unconjugated | |
| Recombinant | |
| FKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |