missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107119

Invitrogen™ Human GM-CSF (aa 109-142) Control Fragment Recombinant Protein

Catalog No. RP107119
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107119 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107119 Supplier Invitrogen™ Supplier No. RP107119

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The GM-CSF gene encodes for a cytokine that regulates the production, differentiation, and function of macrophages and granulocytes. The active form of the protein exists as a homodimer in the extracellular space. This gene is located in a cluster of related genes at the chromosome region 5q31, which has been associated with interstitial deletions in the 5q- syndrome and acute myelogenous leukemia. Other genes in the cluster include interleukins 4, 5, and 13. The gene is involved in promoting tissue inflammation. Elevated levels of cytokines, including the one produced by this gene, have been observed in SARS-CoV-2 infected patients with acute respiratory distress syndrome. Mice that lack this gene or its receptor have been shown to develop pulmonary alveolar proteinosis.

Specifications

Accession Number P04141
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1437
Name Human GM-CSF (aa 109-142) Control Fragment
Quantity 100 μL
Gene Alias colony stimulating factor 2; colony stimulating factor 2 (granulocyte-macrophage); colony-stimulating factor; CSF; CSF2; Csfgm; cytokine; GMCSF; Gm-CSf; granulocyte macrophage colony stimulating factor; granulocyte macrophage-colony stimulating factor; granulocyte-macrophage colony stimulating factor 2; granulocyte-macrophage colony-stimulating factor; MGC131935; MGC138897; MGC151255; MGC151257; MGI-IGM; M-GM-CSF; molgramostin; put. GM-CSF; sargramostim
Common Name GM-CSF
Gene Symbol CSF2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PETSCATQIITFESFKENLKDFLLVIPFDCWEPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less