missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Glypican 3 (aa 464-569) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92009
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GPC3 is a cell surface proteoglycan that bears heparan sulfate. This protein may be involved in the suppression/modulation of growth in the predominantly mesodermal tissues and organs, and may play a role in the modulation of IGF2 interactions with its receptor and thereby modulate its function. Members of the glypican-related integral membrane proteoglycan family contain a core protein anchored to the cytoplasmic membrane via a glycosyl phosphatidylinositol (GPI) linkage. These proteins may play a role in the control of cell division, growth regulation, and tumor predisposition. Deletion mutations in GPC3 are the cause of Simpson-Golabi-Behmel syndrome (SGBS), also known as Simpson dysmorphia syndrome (SDYS). SGBS is a condition characterized by pre- and postnatal overgrowth (gigantism) with visceral and skeletal anomalies.Specifications
| P51654 | |
| Blocking Assay, Control | |
| 2719 | |
| 100 μL | |
| defective in Simpson-Golabi-Behmel overgrowth syndrome; DGSX; glypican 3; glypican proteoglycan 3; glypican-3; Glypican-3 alpha subunit; Glypican-3 beta subunit; Gpc3; GTR22; GTR2-2; heparan sulphate proteoglycan; intestinal protein OCI-5; MXR7; OCI5; OCI-5; proteoglycan GPC3; SDYS; secreted glypican-3; SGB; SGBS; SGBS1 | |
| GPC3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| 1.9 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Glypican 3 (aa 464-569) Control Fragment | |
| RUO | |
| Glypican 3 | |
| Unconjugated | |
| Recombinant | |
| DKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |