missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98336

Invitrogen™ Human GLTSCR1 (aa 1278-1343) Control Fragment Recombinant Protein

Catalog No. RP98336
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98336 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98336 Supplier Invitrogen™ Supplier No. RP98336

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63267 (PA5-63267. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of SWI/SNF chromatin remodeling subcomplex GBAF that carries out key enzymatic activities, changing chromatin structure by altering DNA-histone contacts within a nucleosome in an ATP-dependent manner (PubMed:29374058). May play a role in BRD4-mediated gene transcription (PubMed:21555454). [UniProt]

Specifications

Accession Number Q9NZM4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 29998
Name Human GLTSCR1 (aa 1278-1343) Control Fragment
Quantity 100 μL
Gene Alias BICRA; BRD4 interacting chromatin remodeling complex associated protein; BRD4 interacting chromatin remodelling complex associated protein; BRD4-interacting chromatin-remodeling complex-associated protein; glioma tumor suppressor candidate region gene 1; glioma tumor suppressor candidate region gene 1 protein; glioma tumor suppressor candidate region gene 1 protein; LOW QUALITY PROTEIN: BRD4-interacting chromatin-remodeling complex-associated protein; GLTSCR1
Common Name GLTSCR1
Gene Symbol BICRA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less