missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101852

Invitrogen™ Human GLDC (aa 834-981) Control Fragment Recombinant Protein

Catalog No. RP101852
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101852 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101852 Supplier Invitrogen™ Supplier No. RP101852

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51701 (PA5-51701. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Degradation of glycine is brought about by the glycine cleavage system, which is composed of four mitochondrial protein components: P protein (a pyridoxal phosphate-dependent glycine decarboxylase), H protein (a lipoic acid-containing protein), T protein (a tetrahydrofolate-requiring enzyme), and L protein (a lipoamide dehydrogenase). The protein is the P protein, which binds to glycine and enables the methylamine group from glycine to be transferred to the T protein. Defects in this gene are a cause of nonketotic hyperglycinemia (NKH).

Specifications

Accession Number P23378
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2731
Name Human GLDC (aa 834-981) Control Fragment
Quantity 100 μL
Gene Alias D030049L12Rik; D19Wsu57e; GCE; GCSP; GLDC; Glycine cleavage system P protein; glycine cleavage system protein P; glycine decarboxylase; glycine decarboxylase P-protein; glycine decarboxylase, glycine cleavage system protein P); glycine dehydrogenase (aminomethyl-transferring); glycine dehydrogenase (decarboxylating); glycine dehydrogenase (decarboxylating), mitochondrial; glycine dehydrogenase (decarboxylating; glycine decarboxylase, glycine cleavage system protein P); glycine dehydrogenase [decarboxylating], mitochondrial; HYGN1; RP11-472F14.1
Common Name GLDC
Gene Symbol GLDC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ILNANYMAKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVAGTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHWDRPYSREVAAFPLPFVKPENK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less