missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GKAP1 (aa 276-366) Control Fragment Recombinant Protein

Catalog No. RP95675
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP95675 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP95675 Supplier Invitrogen™ Supplier No. RP95675
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57159 (PA5-57159. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The approximately 142 kDa Tankyrase protein is ubiquitously expressed in mammalian cells and is localized to human telomeres. It has homology to ankyrins and to the catalytic domain of poly (adenosine diphosphate-ribose) polymerase (PARP). Tankyrase binds to TRF1 (telomeric repeat binding factor-1), which negatively regulates the maintenance of telomere length.

Specifications

Accession Number Q5VSY0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 80318
Name Human GKAP1 (aa 276-366) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 42 kD cGMP-dependent protein kinase anchoring protein; 42 kDa; 4933400B15Rik; cGMP-dependent protein kinase anchoring protein; cGMP-dependent protein kinase anchoring protein 42 kDa; cGMP-dependent protein kinase-anchoring protein of 42 kDa; D13Ertd340e; FKSG21; G kinase anchoring protein 1; G kinase-anchoring protein 1; GKAP1; Gkap42; protein kinase anchoring protein GKAP42
Common Name GKAP1
Gene Symbol Gkap1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ITQWEAKYKEVKARNAQLLKMLQEGEMKDKAEILLQVDESQSIKNELTIQVTSLHAALEQERSKVKVLQAELAKYQGGRKGKRNSESDQCR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less