missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104188

Invitrogen™ Human GIPC2 (aa 52-95) Control Fragment Recombinant Protein

Catalog No. RP104188
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104188 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104188 Supplier Invitrogen™ Supplier No. RP104188

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64052 (PA5-64052. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GIPC2 (GIPC PDZ Domain Containing Family Member 2) is a Protein Coding gene. An important paralog of this gene is GIPC1.

Specifications

Accession Number Q8TF65
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54810
Name Human GIPC2 (aa 52-95) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2200002N01Rik; AU021850; GIPC 2; GIPC PDZ domain containing family member 2; GIPC PDZ domain containing family, member 2; GIPC2; PDZ domain protein GIPC2; PDZ domain-containing protein GIPC2; semaF cytoplasmic domain associated protein 2; semaF cytoplasmic domain-associated protein 2; semaphorin cytoplasmic domain associated protein 2; SEMCAP 2; SEMCAP2; SEMCAP-2
Common Name GIPC2
Gene Symbol Gipc2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SATGRVEGFSSIQELYAQIAGAFEISPSEILYCTLNTPKIDMER
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less