missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP92720

Invitrogen™ Human GIMAP6 (aa 1-77) Control Fragment Recombinant Protein

Catalog No. RP92720
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP92720 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP92720 Supplier Invitrogen™ Supplier No. RP92720
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (60%), Rat (60%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55389 (PA5-55389. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene.

Specifications

Accession Number Q6P9H5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 474344
Name Human GIMAP6 (aa 1-77) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833419H03Rik; Gimap6; GTPase IMAP family member 6; GTPase, IMAP family member 6; IAN2; IAN-2; IAN6; IAN-6; immune associated nucleotide 2; immune associated nucleotide 6; immune-associated nucleotide 6; immune-associated nucleotide-binding protein 6; Immunity-associated nucleotide 2 protein; Immunity-associated nucleotide 6 protein; mFLJ00102; mIAN6
Common Name GIMAP6
Gene Symbol GIMAP6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less