missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GIMAP1 (aa 185-252) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100002
Description
Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60858 (PA5-60858. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GIMAP1 belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1.Specifications
| Q8WWP7 | |
| Blocking Assay, Control | |
| 170575 | |
| 100 μL | |
| GIMAP1; GTPase; GTPase IMAP family member 1; GTPase, IMAP family member 1; hIMAP1; Ian2; IAP38; imap; Imap1; Imap38; immune associated nucleotide family member; immune-associated nucleotide-binding protein 2; immune-associated protein 38; immunity associated protein 1; immunity-associated protein; immunity-associated protein 1; immunity-associated protein, 38 kDa | |
| GIMAP1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GIMAP1 (aa 185-252) Control Fragment | |
| RUO | |
| GIMAP1 | |
| Unconjugated | |
| Recombinant | |
| VCAFDNRATGREQEAQVEQLLGMVEGLVLEHKGAHYSNEVYELAQVLRWAGPEERLRRVAERVAARVQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |