missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GFM2 (aa 661-741) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP96919
Description
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57851 (PA5-57851. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GFM2 is involved in mitochondrial translation, which is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. In Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. This gene encodes one of mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. Alternative splicing results in at least three transcript variants encoding distinct isoforms.Specifications
| Q969S9 | |
| Blocking Assay, Control | |
| 84340 | |
| 100 μL | |
| 6530419G12Rik; A930009M04Rik; EFG2; EF-G2mt; EF-G2mt {ECO:0000255; Elongation factor G 2, mitochondrial; elongation factor G 2, mitochondrial {ECO:0000255; Elongation factor G2; G elongation factor; G elongation factor mitochondrial 2; G elongation factor, mitochondrial 2; GFM2; HAMAP-Rule:MF_03059}; hEFG2; mEF-G 2; mEF-G 2 {ECO:0000255; mitochondrial elongation factor G2; mitochondrial ribosome recycling factor 2; MRRF2; MST027; MSTP027; RGD1309854; ribosome-releasing factor 2, mitochondrial; ribosome-releasing factor 2, mitochondrial {ECO:0000255; RRF2; RRF2mt; RRF2mt {ECO:0000255 | |
| Gfm2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GFM2 (aa 661-741) Control Fragment | |
| RUO | |
| GFM2 | |
| Unconjugated | |
| Recombinant | |
| TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYST | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |