missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105060

Invitrogen™ Human Gemin 2 (aa 238-280) Control Fragment Recombinant Protein

Catalog No. RP105060
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105060 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105060 Supplier Invitrogen™ Supplier No. RP105060
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66055 (PA5-66055. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SIP1 is one of the proteins found in the SMN complex, which consists of the survival of motor neuron (SMN) protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal snRNPs and for pre-mRNA splicing. SIP1 interacts directly with the SMN and it is required for formation of the SMN complex. A knockout mouse targeting the mouse homolog of this gene exhibited disrupted snRNP assembly and motor neuron degeneration. However, knockdown of the SIP1 mRNA in motor neurons showed normal motor axons while that of SMN mRNA did show abnormal motor axon outgrowth, indicating that SIP1 may have additional roles outside of the SMN complex.

Specifications

Accession Number O14893
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8487
Name Human Gemin 2 (aa 238-280) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1700012N19Rik; Component of gems 2; gem (nuclear organelle) associated protein 2; gem nuclear organelle associated protein 2; gem nuclear organelle associated protein 2 S homeolog; gem-associated protein 2; GEMIN2; Gemin-2; gemin2.S; SIP 1; SIP1; SIP-1; SIP1 delta; sip1-delta; SMN interacting protein 1-delta; SMN interacting protein-1; SMN-interacting protein 1; survival of motor neuron protein interacting protein 1; Survival of motor neuron protein-interacting protein 1; survivor of motor neuron protein interacting protein 1; XELAEV_18042638mg
Common Name Gemin 2
Gene Symbol GEMIN2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less