missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GDAP1L1 (aa 89-148) Control Fragment Recombinant Protein

Catalog No. RP103879
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP103879 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP103879 Supplier Invitrogen™ Supplier No. RP103879
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64101 (PA5-64101. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein. Several transcript variants encoding different isoforms, as well as a noncoding transcript variant, have been found for this gene.

Specifications

Accession Number Q96MZ0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 78997
Name Human GDAP1L1 (aa 89-148) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias dJ881L22.1; dJ995J12.1.1; ganglioside induced differentiation associated protein 1 like 1; ganglioside induced differentiation associated protein 1-like 1; ganglioside induced differentiation associated protein 1-like 1; ganglioside-induced differentiation-associated protein 1-like 1; ganglioside-induced differentiation-associated protein 1-like 1; Gdap1l; GDAP1L1; GDAP1-L1
Common Name GDAP1L1
Gene Symbol GDAP1L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMPEVGSLQHARVLQYREL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less