missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89946

Invitrogen™ Human GCDFP-15 (aa 40-146) Control Fragment Recombinant Protein

Catalog No. RP89946
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89946 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89946 Supplier Invitrogen™ Supplier No. RP89946

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82381. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gross cystic disease of the breast is benign premenopausal disorder in which cysts are a predominant pathological lesion. These cysts appear to be formed from excessive apocrine cystic secretions. This fluid is composed of several glycoproteins including a unique 15kDa monomer protein, Gross Cystic Disease Fluid Protein-15 (GCDFP15). Cytosolic analysis of normal tissue specimens from all major organs has demonstrated GCDFP15 in apocrine epithelia, lacrimal, ceruminous and Moll's glands and in numerous serous cells of the submandibular, tracheal, bronchial, sublingual and minor salivary glands. GCDFP15 and prostate specific antigen are co-expressed in androgen receptor-positive breast tumours.

Specifications

Accession Number P12273
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5304
Name Human GCDFP-15 (aa 40-146) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 14 kDa submandibular gland protein; gcdfp 15; GCDFP15; GCDFP-15; gp17; GPIP4; Gross cystic disease fluid protein 15; HGNC:8993; mSMGP; PIP; prolactin induced protein; prolactin-induced protein; Prolactin-inducible protein; prolactin-inducible protein homolog; SABP; secretory actin-binding protein; SMGP
Common Name GCDFP-15
Gene Symbol PIP
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FDIPKSVRPNDEVTAVLAVQTELKECMVVKTYLISSIPLQGAFNYKYTACLCDDNPKTFYWDFYTNRTVQIAAVVDVIRELGICPDDAAVIPIKNNRFYTIEILKVE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less