missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GBP7 (aa 523-585) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP100778
Description
Highest antigen sequence indentity to the following orthologs: Mouse (54%), Rat (54%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62355 (PA5-62355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Guanylate-binding proteins, such as GBP7, are induced by interferon and hydrolyze GTP to both GDP and GMP.Specifications
| Q8N8V2 | |
| Blocking Assay, Control | |
| 388646 | |
| 100 μL | |
| 9830147J24Rik; GBP4L; Gbp7; GBP-7; GTP-binding protein 7; guanine nucleotide-binding protein 7; guanylate binding protein 7; Guanylate-binding protein 4-like; Guanylate-binding protein 7 | |
| GBP7 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GBP7 (aa 523-585) Control Fragment | |
| RUO | |
| GBP7 | |
| Unconjugated | |
| Recombinant | |
| FQENIAQLKKKMERERENYMRELRKMLSHKMKVLEELLTEGFKEIFESLNEEINRLKEQIEAA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |