missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GATAD2A (aa 505-627) Control Fragment Recombinant Protein

Catalog No. RP89395
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89395 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89395 Supplier Invitrogen™ Supplier No. RP89395

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcriptional repressor. Enhances MBD2-mediated repression. Efficient repression requires the presence of GATAD2B. [UniProt]

Specifications

Accession Number Q86YP4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 54815
Name Human GATAD2A (aa 505-627) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110066C11Rik; BC031407; C80248; GATA zinc finger domain containing 2 A; GATA zinc finger domain-containing protein 2 A; GATAD2A; Hp66alpha; MGC29315; MGC36975; p66 alpha; p66a; p66alpha; RGD1310596; transcriptional repressor p66 alpha; Transcriptional repressor p66-alpha
Common Name GATAD2A
Gene Symbol GATAD2A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRKLAFRSGEARDWSNGAVLQASSQLSRGSATTPRGVLHTFSPSPKLQNSASATALVSRTGRHSERTVSAGKGSATSNWKKTPLSTGGTLAFVSPSLAVHKSSSAVDRQREYLLDMIPPRSIP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less