missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GATAD1 (aa 1-36) Control Fragment Recombinant Protein

Catalog No. RP107898
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107898 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107898 Supplier Invitrogen™ Supplier No. RP107898

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67262 (PA5-67262. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Component of some chromatin complex recruited to chromatin sites methylated 'Lys-4' of histone H3 (H3K4me).

Specifications

Accession Number Q8WUU5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57798
Name Human GATAD1 (aa 1-36) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2310031E19Rik; 2810047M21Rik; 8430439A17Rik; 9130430G15Rik; B330017N08Rik; CMD2B; ENSMUSG00000073241; GATA zinc finger domain containing 1; GATA zinc finger domain-containing 1-like protein; GATA zinc finger domain-containing protein 1; GATA zinc finger domain-containing protein 1-like protein; Gatad1; im:7150682; ocular development associated; ocular development-associated gene protein; ODAG; RG083M05.2; RG83M5.2; si:dkey-231l1.7; Unknown (protein for MGC:136582); zgc:136582
Common Name GATAD1
Gene Symbol GATAD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MPLGLKPTCSVCKTTSSSMWKKGAQGEILCHHCTGR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less