missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GAS2 (aa 259-312) Control Fragment Recombinant Protein

Catalog No. RP101358
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101358 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101358 Supplier Invitrogen™ Supplier No. RP101358
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63627 (PA5-63627. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Gas2 is a 313 amino acid protein encoded by the human gene GAS2. Gas2 is thought to play a role in apoptosis by acting as a cell death substrate for caspases. Gas2, a component of the microfilament system, is cleaved by a caspase (caspase-3 and caspase-7) at Asparagine 278 during apoptosis. The cleaved form resulting from this dramatically induces the rearrangement of the Actin cytoskeleton and causes potent changes in the shape of the affected cells. Gas2 is believed to also be involved in the membrane ruffling process. During the G0-G1 transition phase Gas2 can be found phosphorylated on its serine residues. Gas2 is a cytoskeleton and peripheral membrane protein that co-localizes with Actin fibers at the cell border and along the stress fibers in growth-arrested fibroblasts. Gas2 is mainly membrane-associated but when hyperphosphorylated it will accumulate at membrane ruffles. Gas2 is specifically expressed at growth arrest and is ubiquitously expressed with highest levels found in liver, lung and kidney.

Specifications

Accession Number O43903
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2620
Name Human GAS2 (aa 259-312) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias GAS 2; Gas2; Gas-2; growth arrest specific 2; growth arrest-specific 2; growth arrest-specific protein 2; RGD1563167
Common Name GAS2
Gene Symbol GAS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FAGYLLKHDPCRMLQISRVDGKTSPIQSKSPTLKDMNPDNYLVVSASYKAKKEI
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less