missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GABRB1 (aa 330-367) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101407
Description
Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111333 (PA5-111333. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.Specifications
| P18505 | |
| Blocking Assay, Control | |
| 2560 | |
| 100 μL | |
| AW061132; B230208N19Rik; GABA beta subunit; GABA(A) receptor; GABA(A) receptor subunit beta-1; GABA(A) receptor, beta 1; GABA(A)R beta-1; GABA-RB; Gabrb1; Gabrb-1; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) A receptor, beta 1; gamma-aminobutyric acid (GABA) A receptor, subunit beta 1; gamma-aminobutyric acid (GABA-A) receptor, subunit beta 1; gamma-aminobutyric acid A receptor beta 1; Gamma-aminobutyric acid receptor beta 1; gamma-aminobutyric acid receptor subunit beta-1; gamma-aminobutyric acid receptor, subunit beta 1; gamma-aminobutyric acid type A receptor beta1 subunit; gamma-aminobutyric acid type A receptor subunit beta1; GARB1; GBRB1; si:dkey-20i10.4 | |
| Gabrb1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GABRB1 (aa 330-367) Control Fragment | |
| RUO | |
| GABRB1 | |
| Unconjugated | |
| Recombinant | |
| IFFGKGPQKKGASKQDQSANEKNKLEMNKVQVDAHGNI | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |