missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP90819

Invitrogen™ Human FZD6 (aa 560-692) Control Fragment Recombinant Protein

Catalog No. RP90819
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP90819 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP90819 Supplier Invitrogen™ Supplier No. RP90819
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The exact function of the protein encoded by this gene is not known. However, this gene product contains a KRAB domain (which is involved in protein-protein interactions) at the N-terminus, and a transposase domain at the C-terminus, suggesting that it may belong to the family of DNA-mediated transposons in human.

Specifications

Accession Number O60353
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8323
Name Human FZD6 (aa 560-692) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias frizzled 6; frizzled 6, seven transmembrane spanning receptor; frizzled class receptor 6; frizzled family receptor 6; frizzled homolog 6; frizzled homolog 6 (Drosophila); Frizzled6; frizzled-6; FZ6; Fz-6; Fzd6; FZD-6; HFZ6; mFz6; NDNC10; seven transmembrane helix receptor
Common Name FZD6
Gene Symbol FZD6
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TSTGATANHGTSAVAITSHDYLGQETLTEIQTSPETSMREVKADGASTPRLREQDCGEPASPAASISRLSGEQVDGKGQAGSVSESARSEGRISPKSDITDTGLAQSNNLQVPSSSEPSSLKGSTSLLVHPVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less