missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98850

Invitrogen™ Human FUZ (aa 329-416) Control Fragment Recombinant Protein

Catalog No. RP98850
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98850 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98850 Supplier Invitrogen™ Supplier No. RP98850

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59724. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FUZ is the human homolog of Drosophila fy protein and belongs to the fuzzy family. The fy gene of Drosophila encodes a novel four-pass transmembrane protein that plays two roles in the development of hairs on the Drosophila wing. The first is to specify the correct orientation of the hair by restricting its initiation to the distal vertex of the cell. The second role is to permit the development of just a single cell hair by maintaining the integrity of the F-actin and microtubule arrays that are required for hair development. In humans, the protein is involved in cytoskeleton function and cell polarity in epithelial cells. The human fuz gene is localized on chromosome 19q13.33.

Specifications

Accession Number Q9BT04
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 80199
Name Human FUZ (aa 329-416) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2600013E07Rik; b2b1273Clo; Fuz; fuzzy homolog; fuzzy homolog (Drosophila); fuzzy planar cell polarity protein; FY; NTD; Protein fuzzy homolog; RGD1310608
Common Name FUZ
Gene Symbol FUZ
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLRNFYTLVTSTHFPPEPGPPEKTEDEVYQAQLPRACYLVLGTEEPGTGVRLVALQLGLRRLLLLLSPQSPTHGLRSLATHTLHALTP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less