missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human FUT7 (aa 258-342) Control Fragment Recombinant Protein

Catalog No. RP106033
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106033 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106033 Supplier Invitrogen™ Supplier No. RP106033

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65341 (PA5-65341. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May catalyze alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.

Specifications

Accession Number Q11130
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2529
Name Human FUT7 (aa 258-342) Control Fragment
Quantity 100 μL
Gene Alias AI853193; alpha (1,3) fucosyltransferase; alpha-(1,3)-fucosyltransferase 7; FTVII; fucosyltransferase 7; fucosyltransferase 7 (alpha (1,3) fucosyltransferase); fucosyltransferase VII; Fuc-TVII; FucT-VII; Fut7; Galactoside 3-L-fucosyltransferase; selectin ligand synthase; selectin-ligand synthase
Common Name FUT7
Gene Symbol FUT7
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less